A practical reference on stability: what it is, how it behaves, what the literature reports, and where the honest uncertainties sit.
Reviewed 2026-03-21. Anything still debated is marked as such rather than presented as settled.
Regulatory expectations for lyophilized products focus on consistent manufacture and documented stability. Batches are often monitored for moisture, appearance, potency, and sterility where applicable. Process parameters such as shelf temperature, chamber pressure, and drying time are recorded and controlled within validated ranges. Open questions remain about how best to predict long-term stability from short accelerated studies, especially for complex biologics. Variations in freezing rate and ice crystal size can produce differences that are not always visible but may affect performance.
After drying, a lyophilized product is usually sealed under vacuum or an inert gas to limit moisture uptake. Residual water content is measured because small changes can alter chemical stability and cake appearance. Storage temperature depends on the material; many biological products are kept at 2–8 °C, while some require −20 °C or colder. Exposure to ambient humidity during handling can cause the porous solid to absorb water and collapse. Container closures and stoppers are therefore selected for low moisture transmission and compatibility.
Stability of a lyophilized solid depends on water content, temperature, and the physical state of the formulation. Amorphous products may slowly absorb moisture and drop below their glass transition temperature, causing collapse or crystallization. Some proteins and peptides can aggregate even in a dry state, especially when exposed to heat or moisture. Accelerated stability studies at elevated temperature and humidity help estimate shelf life, but real-time data remain the basis for expiration dating.
After drying, a lyophilized product is usually sealed under vacuum or an inert gas to limit moisture and oxygen exposure. The container closure system matters because stoppers and seals can allow moisture ingress over time. Storage conditions are selected from stability studies that track potency, cake appearance, and reconstitution behavior. Many freeze-dried materials are kept at controlled room temperature, while some require refrigeration or protection from light.
Quality control for freeze-dried forms includes visual inspection, water content measurement, and reconstitution time. A satisfactory cake is typically uniform, porous, and intact, although minor shrinkage or cracking may be acceptable if specifications allow. Karl Fischer titration, thermal gravimetric analysis, and near-infrared spectroscopy are used to measure water content. Reconstitution is assessed by adding a specified diluent and recording the time and ease of dissolution. Microbiological and particulate tests are added when the product is sterile or intended for injection.
| Property | Value | Notes |
|---|---|---|
| Typical storage temperature | 2–8 °C | Common for biological materials; some require −20 °C or colder |
| Residual moisture specification | 0.5–3.0% w/w | Product-specific; measured after drying |
| Common moisture method | Karl Fischer titration | Coulometric or volumetric; detects water content |
| Cake appearance | Uniform and porous | Collapse, meltback, or cracks are deviations |
| Reconstitution time | Seconds to several minutes | Depends on formulation, cake structure, and diluent |
Analytical methods for lyophilized solids must account for the low moisture content and the fragile cake. Karl Fischer titration is widely used for water content, while near-infrared spectroscopy can measure moisture non-destructively in sealed containers. X-ray diffraction and modulated differential scanning calorimetry help identify crystalline or amorphous phases. Residual solvent analysis may be needed if organic solvents were used during formulation. The combination of these methods supports batch release and long-term stability assessment.
Lyophilized products are typically stored as sealed solids in vials or syringes. Moisture ingress is a major concern because many dried cakes are hygroscopic and can lose stability when exposed to humid air. Storage temperature depends on the formulation; some products are kept refrigerated, while others are stable at room temperature. Container closure integrity and headspace moisture are often monitored. Light protection may also be required for some photosensitive materials.
Quality control for lyophilized materials includes visual inspection, residual moisture measurement, and reconstitution testing. Cake appearance can reveal process problems such as collapse, shrinkage, or meltback, although appearance alone does not prove potency. Residual moisture is commonly measured by Karl Fischer titration or by loss on drying. Reconstitution time is checked because a slow or incomplete dissolve can indicate a change in pore structure. Stability studies track these attributes over time under defined temperature and humidity conditions.
Stability of a lyophilized product depends on its glass transition temperature, the temperature at which the amorphous cake transitions from a glassy to a rubbery state. Storage below this temperature minimizes molecular mobility and slows chemical degradation. If the storage temperature exceeds the glass transition temperature, the cake may collapse, shrink, or become sticky. Accelerated stability studies at elevated temperatures and humidity help predict shelf life, but they do not always reflect real-time behavior. Residual moisture content also plays a critical role in long-term stability.
Reconstitution involves adding a suitable diluent, often sterile water or a buffer, to the dried cake. Gentle swirling or inversion helps dissolve the material without creating excessive foam. The time required for complete dissolution can range from seconds to several minutes and depends on the cake structure and the diluent. Improper reconstitution, such as vigorous shaking or using the wrong diluent, can cause protein aggregation or loss of activity. After reconstitution, the product may have a limited shelf life and should be used according to its labeling.
Lyophilized products are typically hygroscopic and require protection from moisture during storage. Manufacturers seal them in glass vials, often under vacuum or an inert gas such as nitrogen. The container closure system, including the stopper and crimp seal, must prevent water vapor ingress. Storage temperature varies from controlled room temperature to refrigerated or frozen conditions, depending on the formulation. Humidity-controlled environments are essential because even brief exposure to ambient air can degrade the product.
Residual moisture is a key quality attribute for lyophilized products. Water that remains after secondary drying can affect chemical stability, cake structure, and shelf life. Karl Fischer titration is a common method for measuring water content in the dried solid. The target range varies by product, but many biologics are dried to between 0.5% and 3% water by weight. Acceptable limits are set during development and confirmed by stability studies.
Stability studies examine how temperature, humidity, and time influence a lyophilized product. Accelerated conditions provide early information about degradation pathways, while long-term studies support shelf-life claims. The glass transition temperature of the dried formulation can indicate its physical stability, and storage above this temperature may increase molecular mobility and lead to collapse or aggregation. Container closure integrity also matters because moisture or oxygen ingress can degrade the product, so vial stoppers and seals are part of the quality system.
=== Nanotechnology === Operando spectroscopy has become a vital tool for surface chemistry. Nanotechnology, used in materials science, involves active catalytic sites on a reagent surface with at least one dimension in the nano-scale of approximately 1–100 nm. As particle size decreases, surface area increases. This results in a more reactive catalytic surface. The reduced scale of these reactions affords several opportunities while presenting unique challenges; for example, due to the very small size of the crystals (sometimes <5 nm), any X-ray crystallography diffraction signal may be very weak. As catalysis is a surface process, one particular challenge in catalytic studies is resolving the typically weak spectroscopic signal of the catalytically active surface against that of the inactive bulk structure. Moving from the micro to the nano scale increases the surface to volume ratio of the particles, maximizing the signal of the surface relative to that of the bulk. Furthermore, as the scale of the reaction decreases towards nano scale, individual processes can be discerned that would otherwise be lost in the average signal of a bulk reaction composed of multiple coincident steps and species such as spectators, intermediates, and reactive sites.
== Scope of Services == Girteka specializes in temperature-controlled and high-value cargo transportation across the continent, delivering a wide range of goods, including fresh, chilled, frozen, and processed foods. Focusing on the following operational segments within road transportation:
In 2017, around 70,200 Americans died from drug overdose. 28,466 deaths were associated with synthetic opioids such as fentanyl and fentanyl analogs, 15,482 were associated with heroin use, 17,029 with prescription opioids (including methadone), 13,942 with cocaine use, and 10,333 with psychostimulants (including methamphetamine). In 2021, there was an increase in overdose deaths; more than 106,000 drug-related overdoses occurred, including deaths caused by both illegal and prescribed opioids. Of this, 70,601 deaths were caused by synthetic opioids primarily fentanyl. Additionally, 32,537 overdose deaths involved stimulants like cocaine or psychostimulants with abuse potential (primarily methamphetamine). Between 2017 and 2019, rappers Lil Peep, Mac Miller, and Juice Wrld died of drug overdoses related to opioids. William D. Bodner of the Drug Enforcement Administration's Los Angeles field division and special agent in charge of the investigation into Miller's death said in a statement, "The tragic death of Mac Miller is a high-profile example of the tragedy that is occurring on the streets of America every day." In 2023, the Biden administration announced a crackdown on Mexican drug cartels smuggling fentanyl into the United States. The Biden administration also targeted Chinese companies importing chemicals used to make fentanyl. Rahul Gupta led White House efforts to combat the opioid epidemic.
===== Funding freezes ===== From the outset of 2025, NIH funding operations have faced interruptions on an unprecedented scale under the direction of the current executive branch of the U.S. government; disruptions as of March 2025 include the following: • impeding grants for dementia and ALS research; • hindering procurement of necessary resources, such as those for transporting patient blood samples; • preventing a research scientist from consulting with physicians treating children with a devastating rare condition; • interrupting the supply of mice for genetic studies, with years of research being imperiled as a result; • cutting research grants for training doctoral and postdoctoral students. This has led to protests such as the Bethesda Declaration, an open letter from former and current NIH staffers.
The most common set of catabolic reactions in animals can be separated into three main stages. In the first stage, large organic molecules, such as proteins, polysaccharides or lipids, are digested into their smaller components outside cells. Next, these smaller molecules are taken up by cells and converted to smaller molecules, usually acetyl coenzyme A (acetyl-CoA), which releases some energy. Finally, the acetyl group on acetyl-CoA is oxidized to water and carbon dioxide during the citric acid cycle and electron transport chain, releasing more energy while reducing the coenzyme nicotinamide adenine dinucleotide (NAD+) into NADH.
Sources: en.wikipedia.org
=== Barbiturates === Barbiturates are powerful anxiolytics but the risk of abuse and addiction is high. Many experts consider these drugs obsolete for treating anxiety but valuable for the short-term treatment of severe insomnia, though only after benzodiazepines or non-benzodiazepines have failed.
== Chemistry == Bulevirtide is a 47-amino acid long lipopeptide with the following sequence: CH3(CH2)12CO-Gly-Thr-Asn-Leu-Ser-Val-Pro-Asn-Pro-Leu-Gly-Phe-Phe-Pro-Asp-His-Gln-Leu-Asp-Pro-Ala-Phe-Gly-Ala-Asn-Ser-Asn-Asn-Pro-Asp-Trp-Asp-Phe-Asn-Pro-Asn-Lys-Asp-His-Trp-Pro-Glu-Ala-Asn-Lys-Val-Gly-NH2 (C13H27CO-GTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANKVG-NH2)
== Factors that affect BV == The determination of BV is carefully designed to accurately measure some aspects of protein usage whilst eliminating variation from other aspects. When using the test (or considering BV values) care must be taken to ensure the variable of interest is quantified by BV. Factors which affect BV can be grouped into properties of the protein source and properties of the species or individual consuming the protein.
Phosphorus is used in trace amounts as a dopant for n-type semiconductors. The commercial use of gallium compounds is dominated by semiconductor applications – in integrated circuits, cell phones, laser diodes, light-emitting diodes, photodetectors, and solar cells. Selenium is used in the production of solar cells and in high-energy surge protectors. Boron, silicon, germanium, antimony, and tellurium, as well as heavier metals and metalloids such as Sm, Hg, Tl, Pb, Bi, and Se, can be found in topological insulators. These are alloys or compounds which, at ultracold temperatures or room temperature (depending on their composition), are metallic conductors on their surfaces but insulators through their interiors. Cadmium arsenide Cd3As2, at about 1 K, is a Dirac-semimetal – a bulk electronic analogue of graphene – in which electrons travel effectively as massless particles. These two classes of material are thought to have potential quantum computing applications.
== Coaching career == Immediately after Hird retired from playing football, there was much speculation as to whether he would be interested in a coaching role at a club in the AFL, but primarily at Essendon. After initially dodging questions about his future, Hird stated in August 2010 that "There's something in me, deep in my heart, that says at some point I want to coach Essendon". These words came as a surprise to many, including former premiership teammate Matthew Lloyd, who said that Hird had "changed his whole persona in regards to how he's answering his questions... Just in regards to saying, 'I'll coach one day. I want to coach Essendon one day'. Even those type of words, I haven't heard before." These comments by Hird, considered to be Essendon's "favourite son", furthered speculation towards the future of then-Essendon coach Matthew Knights. A rumour emerged following these comments suggesting that Hird was part of an unofficial agreement with the Essendon board to replace Matthew Knights for the 2011 AFL Season. However, two days after Hird's initial comments, he announced that he had changed his mind due to the intense division and speculation over Matthew Knights' future following Hird's initial comments. Hird stated that he was ruling himself out of coaching Essendon for at least three years.
Sources: en.wikipedia.org
== See also == Nanomedicine, the general field Micelle, lipid cored Liposome, lipid bilayer shell, an earlier form with some limitations Lipoplex, a complex of plasmid or linear DNA and lipids Targeted drug delivery mRNA-1273, from Moderna, uses LNPs BNT162b2, from BioNTech/Pfizer, uses LNPs
Secondary ion mass spectrometry (SIMS) was one of the first matrix-free desorption/ionization approaches used to analyze metabolites from biological samples. SIMS uses a high-energy primary ion beam to desorb and generate secondary ions from a surface. The primary advantage of SIMS is its high spatial resolution (as small as 50 nm), a powerful characteristic for tissue imaging with MS. However, SIMS has yet to be readily applied to the analysis of biofluids and tissues because of its limited sensitivity at >500 Da and analyte fragmentation generated by the high-energy primary ion beam. Desorption electrospray ionization (DESI) is a matrix-free technique for analyzing biological samples that uses a charged solvent spray to desorb ions from a surface. Advantages of DESI are that no special surface is required and the analysis is performed at ambient pressure with full access to the sample during acquisition. A limitation of DESI is spatial resolution because "focusing" the charged solvent spray is difficult. However, a recent development termed laser ablation ESI (LAESI) is a promising approach to circumvent this limitation. Most recently, ion trap techniques such as orbitrap mass spectrometry are also applied to metabolomics research. Nuclear magnetic resonance (NMR) spectroscopy is the only detection technique which does not rely on separation of the analytes, and the sample can thus be recovered for further analyses. All kinds of small molecule metabolites can be measured simultaneously - in this sense, NMR is close to being a universal detector.
is the first derivative of concentration with respect to time, i.e. the change in concentration with time. It is derived from a mass balance. Clearance of a substance is sometimes expressed as the inverse of the time constant that describes its removal rate from the body divided by its volume of distribution (or total body water). In steady-state, it is defined as the mass generation rate of a substance (which equals the mass removal rate) divided by its concentration in the blood.
=== Names === Enobosarm is the generic name of the drug and its International Nonproprietary Name (INN). Ostarine was a tentative brand name of the drug created by GTx, Inc. that did not end up being used for marketing purposes but continues to be used as a synonym for the drug. Enobosarm is also known by the pharmaceutical developmental code names S-22 (synthesis paper), GTx-024 (GTx, Inc.), MK-2866 (Merck), and VERU-024 (Veru, Inc.).
Sources: en.wikipedia.org
Most are held in sealed containers at controlled temperatures, often 2–8 °C, while some require frozen storage. Protection from moisture and light helps preserve the dry matrix. Exact conditions are set by the manufacturer or study protocol.
Cake collapse suggests the material exceeded its collapse temperature during drying or later absorbed moisture. It can lead to slower reconstitution, uneven moisture, and reduced stability. Appearance alone may not reveal the cause, so process records and moisture tests are used together.
Some residual moisture is common and may be acceptable within a defined range. Very low moisture can alter stability or increase brittleness, while high moisture promotes hydrolysis and microbial risk. Specifications are based on product-specific stability data.
Sealed vials or containers should be kept at the temperature specified by stability data, often controlled room temperature or 2–8 °C. Moisture and oxygen barriers are important because both can degrade sensitive materials. Opened containers may need immediate use or protection from ambient humidity.